Protein Info for Ga0059261_3213 in Sphingomonas koreensis DSMZ 15582

Annotation: lipoate-protein ligase B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00214: lipoyl(octanoyl) transferase
  • amino acids 34 to 185 (152 residues), 141.3 bits, E=1.3e-45

Best Hits

Swiss-Prot: 68% identical to LIPB_SPHAL: Octanoyltransferase (lipB) from Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)

KEGG orthology group: K03801, lipoyl(octanoyl) transferase [EC: 2.3.1.181] (inferred from 65% identity to sjp:SJA_C1-30580)

Predicted SEED Role

"Octanoate-[acyl-carrier-protein]-protein-N-octanoyltransferase" in subsystem Lipoic acid metabolism

MetaCyc Pathways

• lipoate biosynthesis and incorporation I (2/2 steps found)
• lipoate biosynthesis and incorporation III (Bacillus) (2/3 steps found)
• lipoate biosynthesis and incorporation V (mammals) (2/3 steps found)
• lipoate biosynthesis and incorporation IV (yeast) (4/7 steps found)

KEGG Metabolic Maps

• Lipoic acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.181

Sequence Analysis Tools

See A0A1L6JEW5 at UniProt or InterPro

Protein Sequence (222 amino acids)

>Ga0059261_3213 lipoate-protein ligase B (Sphingomonas koreensis DSMZ 15582)
METKNGIEWRVADHRVPYPEALAEMETRVAEIQNGQAGELIWLLEHPPVYTAGTSADPAE
LIDPRFPVFATGRGGRYTYHGPGQRIGYAMLDLSRRNKDVRCYVHALEGWVIAALGALGI
NAFRAEGRIGIWTRDGGSEAKIGAIGVRVRRWVTMHGFAVNLNPDLDDFNGIVPCGLPEF
PVISAAALGKDISPATFDAALAFAFPAFLDAVGGTCAAEKQG