Protein Info for Ga0059261_3209 in Sphingomonas koreensis DSMZ 15582

Annotation: queuosine biosynthesis protein QueC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF06508: QueC" amino acids 7 to 216 (210 residues), 236.7 bits, see alignment E=2e-74 TIGR00364: queuosine biosynthesis protein QueC" amino acids 7 to 209 (203 residues), 191.3 bits, see alignment E=7.2e-61 PF00733: Asn_synthase" amino acids 9 to 63 (55 residues), 23.3 bits, see alignment E=4.8e-09

Best Hits

Swiss-Prot: 72% identical to QUEC_SPHWW: 7-cyano-7-deazaguanine synthase (queC) from Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273)

KEGG orthology group: K06920, queuosine biosynthesis protein QueC (inferred from 74% identity to sjp:SJA_C1-30620)

Predicted SEED Role

"Queuosine Biosynthesis QueC ATPase" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WG47 at UniProt or InterPro

Protein Sequence (229 amino acids)

>Ga0059261_3209 queuosine biosynthesis protein QueC (Sphingomonas koreensis DSMZ 15582)
MTDSQIAVALVSGGLDSFVSAARARADGYRLLALSVDYNQRHHVELAAARRIAQALGAER
HVVLPLDLSQFGGSALTADIDVPKDGVGEDIPVTYVPARNTIFLSLALGWAEAAGARDLY
IGVNALDYSGYPDCRPEFIEGFEKLAELATKAGVEGAPFRIRAPLQFMSKADIVQEGMRL
GLDLGLSWSCYDPAPGGLHCGLCDSCRLRSKGFEEAGVPDPTRYAETAG