Protein Info for Ga0059261_3206 in Sphingomonas koreensis DSMZ 15582

Annotation: ornithine carbamoyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 PF02729: OTCace_N" amino acids 4 to 149 (146 residues), 159.7 bits, see alignment E=5.7e-51 TIGR00658: ornithine carbamoyltransferase" amino acids 4 to 303 (300 residues), 344.6 bits, see alignment E=2.4e-107 PF00185: OTCace" amino acids 156 to 301 (146 residues), 167.2 bits, see alignment E=3e-53

Best Hits

Swiss-Prot: 74% identical to OTC_NOVAD: Ornithine carbamoyltransferase (argF) from Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CIP 105152 / NBRC 16084 / F199)

KEGG orthology group: None (inferred from 74% identity to nar:Saro_3140)

MetaCyc: 55% identical to ArgF (Bacillus subtilis)
Ornithine carbamoyltransferase. [EC: 2.1.3.3]

Predicted SEED Role

"Ornithine carbamoyltransferase (EC 2.1.3.3)" in subsystem Arginine Biosynthesis extended or Arginine Deiminase Pathway or Arginine and Ornithine Degradation (EC 2.1.3.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WG36 at UniProt or InterPro

Protein Sequence (307 amino acids)

>Ga0059261_3206 ornithine carbamoyltransferase (Sphingomonas koreensis DSMZ 15582)
MTYRNFLSLSDAGADGIAAMLADAIDRKRARAGQPKGAVDADAPLAGRTLAMVFEKNSTR
TRVSFEMAIRQLGGSAVVLDAATSQLGRGETVADTARVLSGYCDAIMVRTDDHAKLLEMA
QYATVPVINGLTDDSHPCQIMADLQTILESGKALPGLKVAWLGDGNNVLASIVEAAGLMH
FDVVAACPQSFALPEEAMALGKGRARTVNDPVEAVAGADVVVTDTWISMGQAHADVKLAA
LAPYQVTEALMAQASPDAKFLHCLPAHRGEEVTDAVIDGPQSLIWPEAENRLHAQKAVLR
WCFGQIG