Protein Info for Ga0059261_3195 in Sphingomonas koreensis DSMZ 15582

Annotation: Uncharacterized protein affecting Mg2+/Co2+ transport

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 132 PF04379: DUF525" amino acids 24 to 109 (86 residues), 128 bits, see alignment E=6.5e-42

Best Hits

Swiss-Prot: 56% identical to APAG_PSEAB: Protein ApaG (apaG) from Pseudomonas aeruginosa (strain UCBPP-PA14)

KEGG orthology group: K06195, ApaG protein (inferred from 71% identity to sch:Sphch_0373)

Predicted SEED Role

"ApaG protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1L6JF21 at UniProt or InterPro

Protein Sequence (132 amino acids)

>Ga0059261_3195 Uncharacterized protein affecting Mg2+/Co2+ transport (Sphingomonas koreensis DSMZ 15582)
VKALFSQEENTRDIVVRVSVSYLPEQSEPDRGRWFWAYHIRIENQSHQAVQLLTRHWIIT
DGRGSRHSVEGEGVVGEQPMIAPGASYDYVSGCPLATPTGSMQGSYRMVGADGMEFDVAI
PKFSLLAPAVAE