Protein Info for Ga0059261_3194 in Sphingomonas koreensis DSMZ 15582
Updated annotation (from data): O-acetylhomoserine sulfhydrylase (EC:2.5.1.49)
Rationale: Annotated as this by multiple resources. KEGG suggests that it is O-succinylhomoserine sulfhydrylase but there is an O-acetyltransferase (Ga0059261_2301) with auxotrophic phenotypes (auxotroph) (SEED_correct)
Original annotation: Cystathionine beta-lyases/cystathionine gamma-synthases
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 48% identical to METZ_MYCTU: O-succinylhomoserine sulfhydrylase (metZ) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
KEGG orthology group: K10764, O-succinylhomoserine sulfhydrylase [EC: 2.5.1.-] (inferred from 82% identity to swi:Swit_1198)Predicted SEED Role
"O-acetylhomoserine sulfhydrylase (EC 2.5.1.49) / O-succinylhomoserine sulfhydrylase (EC 2.5.1.48)" in subsystem Methionine Biosynthesis (EC 2.5.1.48, EC 2.5.1.49)
MetaCyc Pathways
- aspartate superpathway (24/25 steps found)
- superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (17/18 steps found)
- superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
- superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
- superpathway of S-adenosyl-L-methionine biosynthesis (8/9 steps found)
- superpathway of L-methionine biosynthesis (transsulfuration) (8/9 steps found)
- superpathway of L-homoserine and L-methionine biosynthesis (7/8 steps found)
- L-methionine biosynthesis III (4/4 steps found)
- superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (8/10 steps found)
- L-methionine biosynthesis II (5/6 steps found)
- L-homocysteine biosynthesis (2/2 steps found)
- L-methionine biosynthesis I (4/5 steps found)
- superpathway of L-cysteine biosynthesis (fungi) (4/6 steps found)
- homocysteine and cysteine interconversion (2/4 steps found)
- S-methyl-5-thio-α-D-ribose 1-phosphate degradation II (1/5 steps found)
- S-methyl-5-thio-α-D-ribose 1-phosphate degradation III (1/5 steps found)
KEGG Metabolic Maps
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Carotenoid biosynthesis - General
- Cysteine metabolism
- Methionine metabolism
- Porphyrin and chlorophyll metabolism
- Riboflavin metabolism
- Selenoamino acid metabolism
- Sulfur metabolism
- Terpenoid biosynthesis
- Tryptophan metabolism
- Ubiquinone and menaquinone biosynthesis
Isozymes
Compare fitness of predicted isozymes for: 2.5.1.-, 2.5.1.48
Use Curated BLAST to search for 2.5.1.- or 2.5.1.48 or 2.5.1.49
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A1L6JEZ0 at UniProt or InterPro
Protein Sequence (402 amino acids)
>Ga0059261_3194 O-acetylhomoserine sulfhydrylase (EC:2.5.1.49) (Sphingomonas koreensis DSMZ 15582) MKRRTGQDRSITQNWKPATQAIRGGTARSEWGETSEALFLTSGYAYDCAGDAAARFSGDQ QGMTYSRLQNPTVEMLEQRIALLEGAEACRATASGMAAMTAALLCQLSAGDHLIGGRAAF GSCRWLTDTQLPKFGIETTVVDARDPQQFIDAIRPNTKVFFFETPANPTMDVVDLKAVCA IARERGIVTVVDNAFATPALQRPMDFGADVVAYSATKMMDGQGRVLAGAVCGTEEFINNT LLPFHRNTGPTLSPFNAWVVLKGLETLDLRIQRQSENALKVARFLEGRVPRVNFPGLPSH PQHNLAMSQMAAAGPIFSIELDGGRTQAHGLLDALGLIDISNNIGDSRSLMTHPASTTHS GVAEDQRLLMGVGEGMLRLNVGLEDPEDLIADLDQALGSVGL