Protein Info for Ga0059261_3194 in Sphingomonas koreensis DSMZ 15582

Updated annotation (from data): O-acetylhomoserine sulfhydrylase (EC:2.5.1.49)
Rationale: Annotated as this by multiple resources. KEGG suggests that it is O-succinylhomoserine sulfhydrylase but there is an O-acetyltransferase (Ga0059261_2301) with auxotrophic phenotypes (auxotroph) (SEED_correct)
Original annotation: Cystathionine beta-lyases/cystathionine gamma-synthases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01053: Cys_Met_Meta_PP
  • amino acids 19 to 397 (379 residues), 411.6 bits, E=3.5e-127
• PF00266: Aminotran_5
  • amino acids 143 to 223 (81 residues), 26.5 bits, E=4.9e-10
• PF00155: Aminotran_1_2
  • amino acids 145 to 219 (75 residues), 28.8 bits, E=1.1e-10

Best Hits

Swiss-Prot: 48% identical to METZ_MYCTU: O-succinylhomoserine sulfhydrylase (metZ) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K10764, O-succinylhomoserine sulfhydrylase [EC: 2.5.1.-] (inferred from 82% identity to swi:Swit_1198)

Predicted SEED Role

"O-acetylhomoserine sulfhydrylase (EC 2.5.1.49) / O-succinylhomoserine sulfhydrylase (EC 2.5.1.48)" in subsystem Methionine Biosynthesis (EC 2.5.1.48, EC 2.5.1.49)

MetaCyc Pathways

• aspartate superpathway (24/25 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (17/18 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (8/9 steps found)
• superpathway of L-methionine biosynthesis (transsulfuration) (8/9 steps found)
• superpathway of L-homoserine and L-methionine biosynthesis (7/8 steps found)
• L-methionine biosynthesis III (4/4 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (8/10 steps found)
• L-methionine biosynthesis II (5/6 steps found)
• L-homocysteine biosynthesis (2/2 steps found)
• L-methionine biosynthesis I (4/5 steps found)
• superpathway of L-cysteine biosynthesis (fungi) (4/6 steps found)
• homocysteine and cysteine interconversion (2/4 steps found)
• S-methyl-5-thio-α-D-ribose 1-phosphate degradation II (1/5 steps found)
• S-methyl-5-thio-α-D-ribose 1-phosphate degradation III (1/5 steps found)

KEGG Metabolic Maps

• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Carotenoid biosynthesis - General
• Cysteine metabolism
• Methionine metabolism
• Porphyrin and chlorophyll metabolism
• Riboflavin metabolism
• Selenoamino acid metabolism
• Sulfur metabolism
• Terpenoid biosynthesis
• Tryptophan metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.-, 2.5.1.48

Use Curated BLAST to search for 2.5.1.- or 2.5.1.48 or 2.5.1.49

Sequence Analysis Tools

See A0A1L6JEZ0 at UniProt or InterPro

Protein Sequence (402 amino acids)

>Ga0059261_3194 O-acetylhomoserine sulfhydrylase (EC:2.5.1.49) (Sphingomonas koreensis DSMZ 15582)
MKRRTGQDRSITQNWKPATQAIRGGTARSEWGETSEALFLTSGYAYDCAGDAAARFSGDQ
QGMTYSRLQNPTVEMLEQRIALLEGAEACRATASGMAAMTAALLCQLSAGDHLIGGRAAF
GSCRWLTDTQLPKFGIETTVVDARDPQQFIDAIRPNTKVFFFETPANPTMDVVDLKAVCA
IARERGIVTVVDNAFATPALQRPMDFGADVVAYSATKMMDGQGRVLAGAVCGTEEFINNT
LLPFHRNTGPTLSPFNAWVVLKGLETLDLRIQRQSENALKVARFLEGRVPRVNFPGLPSH
PQHNLAMSQMAAAGPIFSIELDGGRTQAHGLLDALGLIDISNNIGDSRSLMTHPASTTHS
GVAEDQRLLMGVGEGMLRLNVGLEDPEDLIADLDQALGSVGL