Protein Info for Ga0059261_3186 in Sphingomonas koreensis DSMZ 15582

Annotation: Excinuclease ABC subunit C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 657 TIGR00194: excinuclease ABC subunit C" amino acids 56 to 635 (580 residues), 549 bits, see alignment E=7.2e-169 PF01541: GIY-YIG" amino acids 64 to 139 (76 residues), 31.5 bits, see alignment E=3.6e-11 PF02151: UVR" amino acids 251 to 282 (32 residues), 35.1 bits, see alignment (E = 1.6e-12) PF08459: UvrC_RNaseH_dom" amino acids 428 to 588 (161 residues), 176.1 bits, see alignment E=9.6e-56 PF14520: HHH_5" amino acids 604 to 652 (49 residues), 36.4 bits, see alignment 1.2e-12

Best Hits

Swiss-Prot: 73% identical to UVRC_NOVAD: UvrABC system protein C (uvrC) from Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CIP 105152 / NBRC 16084 / F199)

KEGG orthology group: K03703, excinuclease ABC subunit C (inferred from 74% identity to sch:Sphch_0350)

Predicted SEED Role

"Excinuclease ABC subunit C" in subsystem DNA repair, UvrABC system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WG28 at UniProt or InterPro

Protein Sequence (657 amino acids)

>Ga0059261_3186 Excinuclease ABC subunit C (Sphingomonas koreensis DSMZ 15582)
LSQSYQMETRAQSPYIARSMSDPNSPNRFNEETATYAVRGSETPDLDTGVAAIRNVLKTL
PARPGVYRMQDARGDVLYVGKARALKNRVANYTQPAKLSNRLRRMIAQTRSMTVVTTNNE
AEALLLEAQLIKRFRPAYNVLLRDDKSFPYILLRGDHAFPRVQLHRGARRIKGDYFGPFA
GAGQVRKTLNALQKLFLLRSCTDGFFNTRDRPCLLYQIRRCSAPCVYRIDRAGYEELVDD
ARAFLSGKSTKVQAKLGEQMQAAAENLDFELAAVLRDRLKALTFIQGSQAINAEGVGDAD
IFALAAKQGTIGIQAFFIRGGQNWGHRAFFPAHTAEVPEEEVLSQFLMQFYEEVPPPKMV
LLDRDLTEAPLLAEALGERAGFKVEISRPQRGARRRLMEQAERNAVEALDRRLAESTTQA
KNLRDIADLFGLAEPPDRIEVYDNSHIQGTNAVGAMIVAGPEGFRTSQYRKFNIRTAATD
NDFAMMREVFTRRFSRAQEEDPDRDKGVWPDLVLIDGGRGQLNAARSVLEELGIEDVCLV
GVAKGPHHGREGREVFHLLDGSERMLPVNSPALFHIQKLRDEVHRFAIGAHRQKRAKTLT
ASPLDEVPGIGPARKKALLMHFGTARAVRGASLEDLRKAPGVSAAVAQQVYDFYHAR