Protein Info for Ga0059261_3175 in Sphingomonas koreensis DSMZ 15582

Annotation: DNA repair protein radc

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 TIGR00608: DNA repair protein RadC" amino acids 18 to 229 (212 residues), 191 bits, see alignment E=1.2e-60 PF04002: RadC" amino acids 110 to 228 (119 residues), 137.3 bits, see alignment E=2.7e-44 PF14464: Prok-JAB" amino acids 120 to 210 (91 residues), 25.4 bits, see alignment E=1.1e-09

Best Hits

Swiss-Prot: 50% identical to Y1728_RHIME: UPF0758 protein R01728 (R01728) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K03630, DNA repair protein RadC (inferred from 74% identity to sjp:SJA_C1-22690)

Predicted SEED Role

"DNA repair protein RadC" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WG04 at UniProt or InterPro

Protein Sequence (230 amino acids)

>Ga0059261_3175 DNA repair protein radc (Sphingomonas koreensis DSMZ 15582)
MGASDSEGITDGTGHRARLRQRLLTDGDGLLDHELIEYLLALAIPRRDTKPLAKTLIHEF
GGIAGLLTADAKAIARVPGMGETSIAALKIAHTAALRLLRGEVAARPVLANWQALLDYLR
ADMAHHAIERVRVLHMNSRNILIRDELMQEGSVDEAPVYVREVIRRAIDLGSAAIILVHN
HPSGDPAPSRADIELTRNVVEAGKRLGIAVHDHIIIGTEGHSSLRSMGLM