Protein Info for Ga0059261_3171 in Sphingomonas koreensis DSMZ 15582

Annotation: Domain of unknown function (DUF4126)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 196 transmembrane" amino acids 6 to 34 (29 residues), see Phobius details amino acids 48 to 68 (21 residues), see Phobius details amino acids 80 to 98 (19 residues), see Phobius details amino acids 157 to 183 (27 residues), see Phobius details PF13548: DUF4126" amino acids 8 to 179 (172 residues), 171.6 bits, see alignment E=6.9e-55

Best Hits

KEGG orthology group: None (inferred from 65% identity to sal:Sala_1970)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WFY9 at UniProt or InterPro

Protein Sequence (196 amino acids)

>Ga0059261_3171 Domain of unknown function (DUF4126) (Sphingomonas koreensis DSMZ 15582)
MGAVEIIGLAASISLLAGWRLYLCVFAVGLAMHTGWVELPQQLKALDVLANPWIIGIAGV
GAVAEFFADKVMWLDSAWDAVHTLVRPVGGALLALAIVDPSDPAWQVMALLLGGSASLLT
HGTKASARAVVNTSPEPVSNAVVSTGEDVLTGGLLVLALANPVAAVVIAVVILAATIVAL
ILLRRWLRRILPAKPA