Protein Info for Ga0059261_3125 in Sphingomonas koreensis DSMZ 15582

Annotation: Imidazoleglycerol-phosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00977: His_biosynth
  • amino acids 5 to 234 (230 residues), 193.5 bits, E=3.9e-61

Best Hits

Swiss-Prot: 57% identical to HIS6_LEPIR: Putative imidazole glycerol phosphate synthase subunit HisF (hisF) from Leptospira interrogans

KEGG orthology group: K02500, cyclase [EC: 4.1.3.-] (inferred from 65% identity to dal:Dalk_1314)

Predicted SEED Role

"Imidazole glycerol phosphate synthase cyclase subunit (EC 4.1.3.-)" in subsystem Histidine Biosynthesis (EC 4.1.3.-)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (43/46 steps found)
• L-histidine biosynthesis (10/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Pyruvate metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.1.3.-

Use Curated BLAST to search for 4.1.3.-

Sequence Analysis Tools

See A0A2M8WFV8 at UniProt or InterPro

Protein Sequence (260 amino acids)

>Ga0059261_3125 Imidazoleglycerol-phosphate synthase (Sphingomonas koreensis DSMZ 15582)
MLRPRIIPCLLIKDGGLVKTVKFGDAKYVGDPINAVRIFNEKQVDELIVANIDATVHGRE
PDYAVIANLAAECRMPLCYSGGVRTAEQVDRIISLGVEKVGISSGAIERPEMISEAARRV
GAQSIVAVMDVKRTGLLKGYELVTHNGTRRTGLKPADWARKAQELGAGEILVNSVDRDGG
MQGYDLDLAQQVRSAVGVPITVLGGAGSLADIEAVLRRFGVIGVSAGSLFVFKGKYRAVL
INYPGGAEKDALFANAMRAT