Protein Info for Ga0059261_3073 in Sphingomonas koreensis DSMZ 15582

Annotation: Type IV secretory pathway, VirB2 components (pilins)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 109 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 52 to 71 (20 residues), see Phobius details amino acids 83 to 104 (22 residues), see Phobius details PF04956: TrbC" amino acids 11 to 99 (89 residues), 87.6 bits, see alignment E=2.8e-29

Best Hits

KEGG orthology group: K03197, type IV secretion system protein VirB2 (inferred from 89% identity to sjp:SJA_C1-29690)

Predicted SEED Role

"Conjugative transfer protein TrbC" in subsystem Type 4 secretion and conjugative transfer

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1L6JFA1 at UniProt or InterPro

Protein Sequence (109 amino acids)

>Ga0059261_3073 Type IV secretory pathway, VirB2 components (pilins) (Sphingomonas koreensis DSMZ 15582)
MRLSVSCRPPLPLAALAFGLAIAVSAPALASGSGMPWEQPLQQVLESVQGPVAKIIAVMV
IITTGLTLAFGETSGGFRRLIQIVFGLSIAFAASSFFLSFFSFGGGALV