Protein Info for Ga0059261_2992 in Sphingomonas koreensis DSMZ 15582

Annotation: Biopolymer transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 139 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details PF02472: ExbD" amino acids 10 to 130 (121 residues), 108.5 bits, see alignment E=1.3e-35

Best Hits

Swiss-Prot: 34% identical to EXBD1_XANCB: Biopolymer transport protein exbD1 (exbD1) from Xanthomonas campestris pv. campestris (strain B100)

KEGG orthology group: K03559, biopolymer transport protein ExbD (inferred from 52% identity to bvi:Bcep1808_5235)

Predicted SEED Role

"Biopolymer transport protein ExbD/TolR" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1L6JFS7 at UniProt or InterPro

Protein Sequence (139 amino acids)

>Ga0059261_2992 Biopolymer transport protein (Sphingomonas koreensis DSMZ 15582)
MAIQIGDEDKPYNEINVTPMIDVMLVLLIIFILLTTAAVQGIKVDLPSASSAKPLEAQKS
RVIAVADDGTISIDAIPVSLSELERELRTSIASTPDLAVILRGDRAVQYDKVMQVLDLCS
KVGVPSLGMASTRPPGGGK