Protein Info for Ga0059261_2984 in Sphingomonas koreensis DSMZ 15582

Annotation: 4-hydroxyphenylpyruvate dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF14696: Glyoxalase_5
  • amino acids 6 to 121 (116 residues), 112.7 bits, E=3.3e-36
• TIGR01263: 4-hydroxyphenylpyruvate dioxygenase
  • amino acids 12 to 340 (329 residues), 376.3 bits, E=9.8e-117
• PF00903: Glyoxalase
  • amino acids 150 to 260 (111 residues), 51.8 bits, E=2.2e-17
• PF13669: Glyoxalase_4
  • amino acids 167 to 253 (87 residues), 33.6 bits, E=8.8e-12

Best Hits

KEGG orthology group: K00457, 4-hydroxyphenylpyruvate dioxygenase [EC: 1.13.11.27] (inferred from 90% identity to sch:Sphch_3215)

Predicted SEED Role

"4-hydroxyphenylpyruvate dioxygenase (EC 1.13.11.27)" in subsystem Aromatic amino acid degradation or Homogentisate pathway of aromatic compound degradation or Plastoquinone Biosynthesis or Tocopherol Biosynthesis (EC 1.13.11.27)

MetaCyc Pathways

• L-tyrosine degradation I (5/5 steps found)
• plastoquinol-9 biosynthesis I (1/3 steps found)
• superpathway of plastoquinol biosynthesis (2/5 steps found)
• L-phenylalanine degradation IV (mammalian, via side chain) (3/9 steps found)
• vitamin E biosynthesis (tocopherols) (1/7 steps found)

KEGG Metabolic Maps

• Phenylalanine metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.27

Sequence Analysis Tools

See A0A2M8WFI4 at UniProt or InterPro

Protein Sequence (345 amino acids)

>Ga0059261_2984 4-hydroxyphenylpyruvate dioxygenase (Sphingomonas koreensis DSMZ 15582)
MTDPANPLGLNGFEFVEFTSPDPAAMAAQFEQLGFVASHRHPTKNITRYKQGRINLMLNR
DDAGRVAKFRGEHGPSASAMAFRVADPVKAMEWALAHGAERTEEDDTVILGIGGSYLYFI
QDGHDLYENWAEIPGWQEAEAANNVGLDLLDHLTHNVRRGQMRVWSQFYKTLFGFEEQKY
FDIKGQATGLFSQAMIAPDKAIRIPLNESQDDKSQIEEFIREYKGEGIQHLALTTDDIYD
TVERLRARGVRLQDTIETYYELVDKRVPGHGEDLERLRKNRILIDGNVGEEGILLQIFTE
NMFGPIFFEIIQRKGNEGFGNGNFQALFESIELDQIRRGVIKVDA