Protein Info for Ga0059261_2956 in Sphingomonas koreensis DSMZ 15582

Annotation: Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 PF00072: Response_reg" amino acids 10 to 116 (107 residues), 103 bits, see alignment E=1.1e-33 PF00486: Trans_reg_C" amino acids 158 to 231 (74 residues), 71.7 bits, see alignment E=4.3e-24

Best Hits

Swiss-Prot: 41% identical to CHVI_RHIRD: Transcriptional regulatory protein ChvI (chvI) from Rhizobium radiobacter

KEGG orthology group: K02483, two-component system, OmpR family, response regulator (inferred from 78% identity to sjp:SJA_C2-01240)

Predicted SEED Role

"Two-component response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1L6JFL8 at UniProt or InterPro

Protein Sequence (241 amino acids)

>Ga0059261_2956 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain (Sphingomonas koreensis DSMZ 15582)
MIKCPMPRSILIVDDDPHIRQLLVFAFGKAGLETVEAGDGEEALAAVARQRPSLIVLDIN
MPRMDGLEVCRRLRAAGDVPILFLSSRDDEIDRVLGIELGGDDYVVKPFSPREVVARSMA
ILRRTAATPPPVENVAKLDYGGLSIDADAWSASWQGVEVPLTVTEFTILRTLASMPSRIF
SRDMIIDRLHGPGFAITDRTVDSHVRNLRRKFADAGCGDLIETRAGVGYRLGACKGTIAA
A