Protein Info for Ga0059261_2944 in Sphingomonas koreensis DSMZ 15582

Annotation: Di- and tripeptidases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF04389: Peptidase_M28" amino acids 106 to 209 (104 residues), 45.4 bits, see alignment E=1.2e-15 PF01546: Peptidase_M20" amino acids 111 to 404 (294 residues), 79.7 bits, see alignment E=4.4e-26 PF07687: M20_dimer" amino acids 217 to 310 (94 residues), 34.2 bits, see alignment E=3.2e-12

Best Hits

KEGG orthology group: None (inferred from 65% identity to cse:Cseg_3523)

Predicted SEED Role

"peptidase, M20/M25/M40 family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WFD8 at UniProt or InterPro

Protein Sequence (425 amino acids)

>Ga0059261_2944 Di- and tripeptidases (Sphingomonas koreensis DSMZ 15582)
MTSLATLALLLAAGSATASATPGDKVAKATLASASYRAAAAQLDREHDRIVEEIVKLTEI
PAPPFKEAKRAAAYREMLAEAGLTDVEIDAEGNAMGLHRGTGPAGGPVIVLAAHLDTVFP
EETNVKVRREGTRLHAPGIGDDTRSLAVLLAYARALKANAIKTKYDILFVGNVGEEGPGD
LRGVRYLFTKGKYKDRVRAFMSMDGTNPERIVTGGVGSKRYRVTYKGPGGHSYGAFGLVN
PMVAAGRTVTDFYTIPVPKTPKTTYAASVTGGGTSVNSIPNEIFVEFDMRSENPAELAKV
EARFKAIVQASVDAENAARSTREGKITADLKMIGDRPAGSTPATAEIVQIATAVITAKGM
KPAASFSSTDSNLPMSLGIPAITIGSGGKGDRAHSLDEWIDVEKGASVQGMSVGLGILLA
AAGAK