Protein Info for Ga0059261_2930 in Sphingomonas koreensis DSMZ 15582

Annotation: Predicted Na+-dependent transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 39 to 58 (20 residues), see Phobius details amino acids 73 to 95 (23 residues), see Phobius details amino acids 101 to 122 (22 residues), see Phobius details amino acids 132 to 155 (24 residues), see Phobius details amino acids 170 to 189 (20 residues), see Phobius details amino acids 205 to 225 (21 residues), see Phobius details amino acids 231 to 252 (22 residues), see Phobius details amino acids 282 to 302 (21 residues), see Phobius details PF13593: SBF_like" amino acids 12 to 317 (306 residues), 333 bits, see alignment E=2e-103 PF01758: SBF" amino acids 57 to 216 (160 residues), 33.9 bits, see alignment E=2.7e-12

Best Hits

KEGG orthology group: K14347, solute carrier family 10 (sodium/bile acid cotransporter), member 7 (inferred from 61% identity to cak:Caul_0525)

Predicted SEED Role

"Sodium - Bile acid symporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WFB7 at UniProt or InterPro

Protein Sequence (340 amino acids)

>Ga0059261_2930 Predicted Na+-dependent transporter (Sphingomonas koreensis DSMZ 15582)
MNALLRRLRLDPYIVAIMAMVAVAAIVPAKGAGKDVLDQVVHAAIAILFFLYGARISPQA
IWAGMTHWRLQGLVFATTFLVFPLVGLGIVALAGGYLDSGLAIGLMFLCLLPSTVQSSIA
FTSIARGNVPAAICSASVSNLAGVVITPLLATMLLSAHSGGMSLGAVRDIALQILLPFVV
GQFARPFIGNWLSRRKTLTMVFDRGSILLVVYSAFSAGVVAGIWSKVTPQSLTLVIVLDL
VILGIVLVFTTAASRLLRFPVEDEIAIVFCGSKKSMASGLPMANIIFPASTVGLIVLPLM
LFHQMQLMVCAALARRYGQRPEEAAPPVAVVARPENCRAG