Protein Info for Ga0059261_2929 in Sphingomonas koreensis DSMZ 15582

Updated annotation (from data): oxygen-dependent methionine synthase, methyltransferase component MesD
Rationale: Required for methionine synthesis in the absence of cobalamin. Contains the C-terminal domain of MetE (catalytic and homocysteine-binding) but not the N-terminal (folate-binding) domain. Requires MesX (Ga0059261_2928, DUF1852) and oxygen, but not 5-methyltetrahydrofolate. See https://doi.org/10.1101/2020.04.21.054031
Original annotation: methionine synthase (B12-independent) (EC 2.1.1.14)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01717: Meth_synt_2
  • amino acids 5 to 328 (324 residues), 127.4 bits, E=3.8e-41

Best Hits

KEGG orthology group: K00549, 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase [EC: 2.1.1.14] (inferred from 87% identity to pfl:PFL_3511)

Predicted SEED Role

"5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase (EC 2.1.1.14)" in subsystem Methionine Biosynthesis (EC 2.1.1.14)

MetaCyc Pathways

• aspartate superpathway (24/25 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (17/18 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (8/9 steps found)
• superpathway of L-methionine biosynthesis (transsulfuration) (8/9 steps found)
• superpathway of L-homoserine and L-methionine biosynthesis (7/8 steps found)
• L-methionine biosynthesis III (4/4 steps found)
• S-adenosyl-L-methionine salvage II (3/3 steps found)
• L-methionine biosynthesis II (5/6 steps found)
• L-methionine biosynthesis I (4/5 steps found)
• seleno-amino acid biosynthesis (plants) (3/5 steps found)
• S-adenosyl-L-methionine salvage I (2/4 steps found)
• superpathway of seleno-compound metabolism (8/19 steps found)

KEGG Metabolic Maps

• Biosynthesis of plant hormones
• Methionine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.14

Use Curated BLAST to search for 2.1.1.14

Sequence Analysis Tools

See A0A2M8WFA5 at UniProt or InterPro

Protein Sequence (342 amino acids)

>Ga0059261_2929 oxygen-dependent methionine synthase, methyltransferase component MesD (Sphingomonas koreensis DSMZ 15582)
MNIVLPTSTAGSLPKPAWLAQPETLWSPWKLEGEELVAGKQDALRLAVEDQRQAGISIVG
DGEQTRQHFVTTFIEHLSGVDFEKRETVRIRNRYDASVPTVVGAVSRPNPVFVDDAKFLR
AQTDQSIKWTLPGPMTMIDTLYDAHYRSREKLAWEFARILNQEARELEAAGVDIIQFDEP
AFNVFFDEANDWGIATLEKAAEGLTCETAVHICYGYGIKANTDWKKTLGSEWRQYEQTFP
NLQKSKIDIVSLECHHSHVPMDLIELIRGKKVMVGAIDVASDTVETPEEVADTLRRALAF
VDADKLYPSTNCGMAPLSRSVARGKLNALGAGAAIVRRELSA