Protein Info for Ga0059261_2914 in Sphingomonas koreensis DSMZ 15582

Annotation: Type IV secretory pathway, TrbD component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 90 transmembrane" amino acids 24 to 44 (21 residues), see Phobius details amino acids 49 to 68 (20 residues), see Phobius details PF05101: VirB3" amino acids 12 to 86 (75 residues), 34.8 bits, see alignment E=7.7e-13

Best Hits

KEGG orthology group: K03198, type IV secretion system protein VirB3 (inferred from 78% identity to sch:Sphch_2737)

Predicted SEED Role

"Conjugative transfer protein TrbD" in subsystem Type 4 secretion and conjugative transfer

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WF94 at UniProt or InterPro

Protein Sequence (90 amino acids)

>Ga0059261_2914 Type IV secretory pathway, TrbD component (Sphingomonas koreensis DSMZ 15582)
VIGTGQHIDGFEAPMHRALAEPILLGGAPRAIAIVNGTLAAALGLGLQQWIAGLIIWAFG
HTLAVFAAKRDPDFAPVLARHLRQKGRLSC