Protein Info for Ga0059261_2913 in Sphingomonas koreensis DSMZ 15582

Annotation: Type IV secretory pathway, VirB2 components (pilins)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 111 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 55 to 72 (18 residues), see Phobius details amino acids 84 to 108 (25 residues), see Phobius details PF04956: TrbC" amino acids 7 to 100 (94 residues), 85.6 bits, see alignment E=1.1e-28

Best Hits

KEGG orthology group: K03197, type IV secretion system protein VirB2 (inferred from 85% identity to mlo:mlr6398)

Predicted SEED Role

"Conjugative transfer protein TrbC" in subsystem Type 4 secretion and conjugative transfer

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WF98 at UniProt or InterPro

Protein Sequence (111 amino acids)

>Ga0059261_2913 Type IV secretory pathway, VirB2 components (pilins) (Sphingomonas koreensis DSMZ 15582)
MRLSRISQTSNIVTVAAVAALGLAIATTAQAAGSGMPWEEPLQQVLESVQGPVAKIVAVI
IIIVTGLTLAFGETAGGFRRLIQIVFGLSIAFAASSFFLSFFSFGGGVLIS