Protein Info for Ga0059261_2879 in Sphingomonas koreensis DSMZ 15582

Annotation: Glycerol dehydrogenase and related enzymes

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00465: Fe-ADH
  • amino acids 8 to 323 (316 residues), 152.1 bits, E=2e-48
• PF13685: Fe-ADH_2
  • amino acids 14 to 272 (259 residues), 96.5 bits, E=2.2e-31

Best Hits

KEGG orthology group: K00005, glycerol dehydrogenase [EC: 1.1.1.6] (inferred from 49% identity to mno:Mnod_5662)

Predicted SEED Role

"Glycerol dehydrogenase (EC 1.1.1.6)" in subsystem Respiratory dehydrogenases 1 (EC 1.1.1.6)

MetaCyc Pathways

• glycerol degradation II (1/2 steps found)
• glycerol degradation V (1/2 steps found)
• glycerol degradation to butanol (10/16 steps found)
• superpathway of glycerol degradation to 1,3-propanediol (1/4 steps found)

KEGG Metabolic Maps

• Glycerolipid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.6

Sequence Analysis Tools

See A0A2M8WF61 at UniProt or InterPro

Protein Sequence (358 amino acids)

>Ga0059261_2879 Glycerol dehydrogenase and related enzymes (Sphingomonas koreensis DSMZ 15582)
MIRIFGGPTRYVQGPGAIGELGTLTERLTKRPLLVVDADVLPFVEAQLSTAFAGRPSITL
AFRGEVTHAAIDLLVEQAGDADCVIGIGGGKGLDAAKGVAFKLGLPFIAVPSIASNDSPT
GRSMAIYNDEHVLVAIETIPDSPLLVVTDTQLIANAPARFLRTGMGDALAKKFEAERAVA
DGASNFFGTRQLRTALAIADACYQTLREHGVAAMAAAERHEPDEAFEAVVEANVLMAGLA
WESGGLSYAHAVVRGLVKARGAASAPHGDHVGYATLVQLAIEGRDDGFILDVIGFNRSVG
LPASLAELDMGSPTPDEIAEIARLTTIGPKGGRIIVNAGPGQIADAIKRVEQLATRES