Protein Info for Ga0059261_2764 in Sphingomonas koreensis DSMZ 15582

Annotation: Site-specific recombinase XerD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 PF02899: Phage_int_SAM_1" amino acids 10 to 91 (82 residues), 48.2 bits, see alignment E=1.1e-16 PF00589: Phage_integrase" amino acids 135 to 285 (151 residues), 117 bits, see alignment E=8e-38

Best Hits

Swiss-Prot: 49% identical to XERC_BRUME: Tyrosine recombinase XerC (xerC) from Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)

KEGG orthology group: K03733, integrase/recombinase XerC (inferred from 76% identity to sch:Sphch_1706)

Predicted SEED Role

"Integrase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WEW7 at UniProt or InterPro

Protein Sequence (298 amino acids)

>Ga0059261_2764 Site-specific recombinase XerD (Sphingomonas koreensis DSMZ 15582)
MDEPPLPLLFAAHLARDRRRSAHTVRAYGATAVRLVAFLGGHWGEAVTREGLRRASAADL
RAYLAHRRSGGLTNASAARELSAVRAFLIFAGDADGADIPRLRGPRVKKGIPRPVSPDEA
LALAEDVADDAREPWIAARDLAVLLLLYGAGLRIGEAMGLTGAVLPLGETMRVTGKRGKT
RIVPLLPQVRDAVEDYVRRSPYGTAPGEALFRGARGGHLSPAIIRRSVRAARTRLGLPPR
TTPHALRHSFATHLLGRGADLRALQELLGHASLSSTQIYTAVDAAHLLDVYRNAHPRA