Protein Info for Ga0059261_2763 in Sphingomonas koreensis DSMZ 15582

Annotation: Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 transmembrane" amino acids 86 to 108 (23 residues), see Phobius details PF00561: Abhydrolase_1" amino acids 21 to 133 (113 residues), 43.7 bits, see alignment E=5.5e-15 PF12146: Hydrolase_4" amino acids 22 to 125 (104 residues), 38.7 bits, see alignment E=1.5e-13 PF12697: Abhydrolase_6" amino acids 23 to 226 (204 residues), 39.9 bits, see alignment E=1.5e-13 PF00326: Peptidase_S9" amino acids 44 to 226 (183 residues), 27.7 bits, see alignment E=3.7e-10

Best Hits

KEGG orthology group: None (inferred from 62% identity to sch:Sphch_2098)

Predicted SEED Role

"2-hydroxymuconic semialdehyde hydrolase (EC 3.1.1.-)" (EC 3.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.-

Use Curated BLAST to search for 3.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WET9 at UniProt or InterPro

Protein Sequence (242 amino acids)

>Ga0059261_2763 Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) (Sphingomonas koreensis DSMZ 15582)
MQTIERNGNALAYIHAPGNGPTIVFLPGYASDMSGSKAVAIDTWARETGRACLRFDYAGC
GESGGAFADQTLESWRDDALAVIDAATAGPLVLVGSSMGGWIMLLTALARPERVVAMVGI
AAAPDFTDWGFTPEQKAVIQAEGCLREPSIYSPEPTVTTRRFWESGEANRLLGAPIDIAV
PARLIHGQRDPDVPWEHSLTLAGLLRSDDVQTILVKDGDHRLSRPQDIALILKVIEDLSA
AS