Protein Info for Ga0059261_2701 in Sphingomonas koreensis DSMZ 15582

Annotation: Protein-disulfide isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF18312: ScsC_N" amino acids 38 to 68 (31 residues), 44.3 bits, see alignment 1.7e-15 PF13462: Thioredoxin_4" amino acids 88 to 240 (153 residues), 76.8 bits, see alignment E=3.4e-25 PF01323: DSBA" amino acids 97 to 239 (143 residues), 72.9 bits, see alignment E=4.6e-24

Best Hits

KEGG orthology group: None (inferred from 51% identity to sch:Sphch_2912)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1L6J5Y7 at UniProt or InterPro

Protein Sequence (246 amino acids)

>Ga0059261_2701 Protein-disulfide isomerase (Sphingomonas koreensis DSMZ 15582)
MVKNPLALAGLLALSAAIGAGAVLGVQALVPAGVAGIDEARVGKIVRNYVLENPEILPEA
MKRLQERETGKAVASSRSAITEPYASAWEGNPKGDVTVAVYMDYACGYCRASLPMIARLV
AEDSNVRIVYRELPVLSEVSRVAARWGLAAAEQGKFKPFHTALYSAGQLSEASIRAASAS
AGLDDAKAQAALATPRVEAEIARNLDTAGKLGVTGTPSWVVGDRVISGMVPYEVLQDAVK
AARKKG