Protein Info for Ga0059261_2670 in Sphingomonas koreensis DSMZ 15582

Annotation: Predicted kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

No protein families (PFam or TIGRFam), signal peptides, or transmembrane helices were found in this protein.

Best Hits

KEGG orthology group: None (inferred from 56% identity to cse:Cseg_0938)

Predicted SEED Role

"D-glycerate 3-kinase (EC 2.7.1.31), plant type" in subsystem Photorespiration (oxidative C2 cycle) (EC 2.7.1.31)

MetaCyc Pathways

• photorespiration I (6/9 steps found)
• photorespiration III (6/9 steps found)

KEGG Metabolic Maps

• Glycerolipid metabolism
• Glycine, serine and threonine metabolism
• Glyoxylate and dicarboxylate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.31

Sequence Analysis Tools

See A0A2M8WEK6 at UniProt or InterPro

Protein Sequence (265 amino acids)

>Ga0059261_2670 Predicted kinase (Sphingomonas koreensis DSMZ 15582)
LTASLEIVARAARGWLGPRPLILGICGSQGSGKSTLARGLVDALGVRAATLSLDDLYLDK
AARAALARDIHPLLATRGVPLTHDVALGRSILDAVRAGQPVRLPRFDKASDEPLAQAQWE
AIDAPLDLLIFEGWCVGAHAQPAADLIAPVNDLERAEDPDGLWRRAVNAALAGPYQALFA
RLDRLVLLAAPDFDVVRGWRAQQEAALRASLDEQGRDPALAMSDMQIARFIQHYERITRA
ILQEMPGRADLALPLGPDRELIGKT