Protein Info for Ga0059261_2605 in Sphingomonas koreensis DSMZ 15582

Annotation: Threonine dehydrogenase and related Zn-dependent dehydrogenases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 61% identical to TDH_RUEPO: L-threonine 3-dehydrogenase (tdh) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

KEGG orthology group: K00060, threonine 3-dehydrogenase [EC: 1.1.1.103] (inferred from 65% identity to bsb:Bresu_2739)

MetaCyc: 60% identical to threonine dehydrogenase (Escherichia coli K-12 substr. MG1655)
L-threonine 3-dehydrogenase. [EC: 1.1.1.103]

Predicted SEED Role

"L-threonine 3-dehydrogenase (EC 1.1.1.103)" in subsystem Glycine Biosynthesis or Threonine degradation (EC 1.1.1.103)

MetaCyc Pathways

superpathway of L-threonine metabolism (14/18 steps found)
L-threonine degradation II (2/2 steps found)
L-threonine degradation III (to methylglyoxal) (2/3 steps found)
aminopropanol phosphate biosynthesis II (2/4 steps found)

KEGG Metabolic Maps

Glycine, serine and threonine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.103

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1L6J5W3 at UniProt or InterPro

Protein Sequence (341 amino acids)

>Ga0059261_2605 Threonine dehydrogenase and related Zn-dependent dehydrogenases (Sphingomonas koreensis DSMZ 15582)
MRGLAKLHAREGIWETEAPVPTPGPDDILIRVRRTAICGTDLHIYNWDDWAARTIPVPMI
VGHEFSGEIVEIGEAVTRPLCIGQRVSGEGHIIDFDSSAARAGRFHLDPGTVGVGVNRQG
AFADYLCIPAFNVVPLPDDVSDDVGALLDPFGNAVHTAQQFDLMGEDVLVTGAGPIGIMA
AAVARRAGARSVVITDINPYRLDLAARLADVRPVNTLEEDLREVMAAEGIDDGFAVALEM
SGAPVAINQAIGALRMGGGLAMLGIPGGSMDVAWSDIILKALTIRGVYGREMFGTWQKMF
GLIRGGLDLSPLITHRLDARDFQQGFDAMRAGRAGKVVLSW