Protein Info for Ga0059261_2601 in Sphingomonas koreensis DSMZ 15582

Annotation: DNA-methyltransferase (dcm)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 TIGR00675: DNA (cytosine-5-)-methyltransferase" amino acids 18 to 346 (329 residues), 108.3 bits, see alignment E=3.2e-35 PF00145: DNA_methylase" amino acids 18 to 348 (331 residues), 163.1 bits, see alignment E=5.8e-52

Best Hits

KEGG orthology group: K00558, DNA (cytosine-5-)-methyltransferase [EC: 2.1.1.37] (inferred from 73% identity to sch:Sphch_2001)

Predicted SEED Role

"DNA-cytosine methyltransferase (EC 2.1.1.37)" (EC 2.1.1.37)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.37

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WEE6 at UniProt or InterPro

Protein Sequence (368 amino acids)

>Ga0059261_2601 DNA-methyltransferase (dcm) (Sphingomonas koreensis DSMZ 15582)
MNGETALHIEANGRSTAVVDLFCGAGGLAYGLQAAGLTVKAGVDLDPSCRYPIEKNTGAE
FALKDISELKPAELRRWFGDAQVRVLAGCAPCQPFSTYSQSRKSVDRRWTLLKQFQRLAL
AVKPEIVTMENVPGLATQAVWKRFTAALEKAKYHVSWREVSCDEFGVPQSRRRLVLLASL
LGPIELRPVEGVLKLTVRDVIENLPPIEAGSSAPIDRLHASASLTARNLERIRASRPGGT
WRDWPEDLRAPCHRKITGKTYPSVYGRMEWDKPAPTMTTQCYGFGNGRFGHPEQDRAISL
REAAILQSFPREYSFLGEEDDVTFERLGTLIGNAVPPKLGEAIGRSILAHIDALDNDRPT
LEGQLDLR