Protein Info for Ga0059261_2473 in Sphingomonas koreensis DSMZ 15582

Annotation: 2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase (catechol pathway)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 PF18288: FAA_hydro_N_2" amino acids 1 to 76 (76 residues), 79.3 bits, see alignment E=2.4e-26 PF01557: FAA_hydrolase" amino acids 80 to 332 (253 residues), 111.5 bits, see alignment E=5e-36

Best Hits

KEGG orthology group: None (inferred from 77% identity to sal:Sala_1124)

Predicted SEED Role

"Fumarylacetoacetase (EC 3.7.1.2)" in subsystem Homogentisate pathway of aromatic compound degradation or Salicylate and gentisate catabolism (EC 3.7.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.7.1.2

Use Curated BLAST to search for 3.7.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1L6J792 at UniProt or InterPro

Protein Sequence (334 amino acids)

>Ga0059261_2473 2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase (catechol pathway) (Sphingomonas koreensis DSMZ 15582)
MKLASLKHGRDGKLVVVSNDLAWCADAAHIAPTLQAALDDWDRLEGDLRNLATDLEHETI
PMLRFHERQAAAPLPRAYQWADGSAYVNHVALVRQARGAEMPESFWHDPLMYQGGSDGFL
GARDPIPLADESWGCDLEAEVVVVTGDVPLGVSREDALAAIRLVGLTNDVSLRNLIPGEL
AKGFGFFQSKPASAFSPVFVTPDSLGDWWKDGKLHRKLMVDLNGKPFGRAEAGEDMTFDF
GTLVAHAAKTRALGAGTIIGSGTVSNRDANGGPGKPIAEGGVGYSCLAEVRTVETINGGA
PVTPFLKAGDTVRIWAEDDKHHPIFGVIEQTVGG