Protein Info for Ga0059261_2323 in Sphingomonas koreensis DSMZ 15582

Annotation: 3-oxoacyl-(acyl-carrier-protein) synthase III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 TIGR00747: 3-oxoacyl-[acyl-carrier-protein] synthase III" amino acids 7 to 326 (320 residues), 420.1 bits, see alignment E=2.6e-130 PF00108: Thiolase_N" amino acids 53 to 150 (98 residues), 31.5 bits, see alignment E=1.8e-11 PF08545: ACP_syn_III" amino acids 111 to 193 (83 residues), 109.8 bits, see alignment E=7.2e-36 PF08541: ACP_syn_III_C" amino acids 237 to 325 (89 residues), 128.6 bits, see alignment E=1.2e-41

Best Hits

Swiss-Prot: 79% identical to FABH_SPHWW: 3-oxoacyl-[acyl-carrier-protein] synthase 3 (fabH) from Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273)

KEGG orthology group: K00648, 3-oxoacyl-[acyl-carrier-protein] synthase III [EC: 2.3.1.180] (inferred from 80% identity to sjp:SJA_C1-32390)

Predicted SEED Role

"3-oxoacyl-[acyl-carrier-protein] synthase, KASIII (EC 2.3.1.180)" (EC 2.3.1.180)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.180

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WDK8 at UniProt or InterPro

Protein Sequence (326 amino acids)

>Ga0059261_2323 3-oxoacyl-(acyl-carrier-protein) synthase III (Sphingomonas koreensis DSMZ 15582)
MTELVRRAVIAGTGSALPPRRVSNAELAEQVDTSDEWIVERTGIRFRHIAADGETTSTLA
TDAARAALAAAGIEAAAIDLIVLATATPDQTFPASATKVQAALGINDCVAFDVAAVCSGF
LYALQVAESMIRAGSAEKALVIGAETFSRILDWEDRATCVLFGDGAGAIVLEAQASEAAG
GRGVLATKLHADGRHNQLLYVDGGPSTTGTVGKLRMKGKEVFRHAVVNLASVMGESLAAA
GLEASDVDWVVPHQANARILDATAKKLGLAPEKVIVTVDRHANTSAASVPLALDAAVRDG
RIKRGDLLVLEAMGGGFTWGASVVRF