Protein Info for Ga0059261_2294 in Sphingomonas koreensis DSMZ 15582

Annotation: Cell division protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 transmembrane" amino acids 22 to 45 (24 residues), see Phobius details amino acids 167 to 189 (23 residues), see Phobius details amino acids 222 to 244 (23 residues), see Phobius details amino acids 266 to 288 (23 residues), see Phobius details PF02687: FtsX" amino acids 173 to 284 (112 residues), 33.8 bits, see alignment E=1.5e-12

Best Hits

KEGG orthology group: K09811, cell division transport system permease protein (inferred from 46% identity to swi:Swit_3012)

Predicted SEED Role

"Cell division protein FtsX" in subsystem Bacterial Cell Division

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WDJ0 at UniProt or InterPro

Protein Sequence (296 amino acids)

>Ga0059261_2294 Cell division protein (Sphingomonas koreensis DSMZ 15582)
MNPFVRNKPEDRLLDESRRTRGMLWVMAIMLFLTVLAAALGLGMAGASRTLDRQLAGRLT
IQLVEGDPARRDAAAKAIVQRVRTLPGVTRVAEVDRNRLAELLEPWLGEAGLDADLPMPA
MIDVDLASGDAAGIERVRAAARAVAPAAQIDRHAQWLSPVSAFLNTITWFAVALVVLMAT
VTTIVVLLTARGGLDTHRDTIAVLHMLGSTDMQVARLFQRRIALDTLLGGLLGTTAALAM
VWLLGQQAAGLGSELLGGVSLVPLDWLLLLALPLVFALMALLAARVAVLGTLGKTL