Protein Info for Ga0059261_2258 in Sphingomonas koreensis DSMZ 15582

Annotation: Sterol desaturase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 transmembrane" amino acids 12 to 28 (17 residues), see Phobius details amino acids 40 to 66 (27 residues), see Phobius details amino acids 78 to 96 (19 residues), see Phobius details amino acids 141 to 166 (26 residues), see Phobius details PF04116: FA_hydroxylase" amino acids 82 to 217 (136 residues), 103.2 bits, see alignment E=7.7e-34

Best Hits

KEGG orthology group: None (inferred from 70% identity to sal:Sala_2332)

Predicted SEED Role

"Sterol desaturase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WDF7 at UniProt or InterPro

Protein Sequence (333 amino acids)

>Ga0059261_2258 Sterol desaturase (Sphingomonas koreensis DSMZ 15582)
MPDLPDPVDLAIPAFVALVLAEMLVARAKDRSRYCPRDTLTSLMLGFGSTIASVLAGGMV
FALATWVHQFRLFDISYAWYWFVLAFVLDDLAYYVFHRSAHRVRWFWASHVIHHSSQHYN
LTTALRQTWTGFFSLGFVFRLPLFLIGFPPAMVFFCAGLNLVYQFWIHTEVIGRTPRWFE
AVMNTPSHHRVHHATNARYLDKNYAGVFIVWDKMFGTFEPERDDDRPRYGIVHNLPDFSI
LRAAFHEWWGIAKDVRTAPGLKARLGYMFGPPGWSHDGSRDTSETIKARWLARQSASASA
DGDNEASDRGEPWKKPTSSSSGPDPEAAPPRAA