Protein Info for Ga0059261_2252 in Sphingomonas koreensis DSMZ 15582

Annotation: Predicted Zn-dependent proteases and their inactivated homologs

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 473 PF01523: PmbA_TldD_1st" amino acids 34 to 91 (58 residues), 45.5 bits, see alignment 1e-15 PF19290: PmbA_TldD_2nd" amino acids 120 to 229 (110 residues), 64.7 bits, see alignment E=1.7e-21 PF19289: PmbA_TldD_3rd" amino acids 237 to 470 (234 residues), 224.9 bits, see alignment E=1e-70

Best Hits

KEGG orthology group: K03568, TldD protein (inferred from 81% identity to sch:Sphch_1937)

Predicted SEED Role

"TldD protein, part of TldE/TldD proteolytic complex"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WDD6 at UniProt or InterPro

Protein Sequence (473 amino acids)

>Ga0059261_2252 Predicted Zn-dependent proteases and their inactivated homologs (Sphingomonas koreensis DSMZ 15582)
MYSDPRGFLYRDGFDADAAQRLTALILGRAEDGELYLQYRKSEAFGFDDGRLKTASYNTD
SGFGLRAVSGETTAFAHANEISQAAIRRAGETMALIDPATGPKAAAPARTNRHLYTDADP
LDLVPFADKVNLCQTIDAAARARDPRVVQVSASLLGSWSVVEIVRPDGFIATDVRPLVRL
NVSIVVEANGRRETGSFGTGGRALYDRLFEPATWNRAIDEALAQALVNLEAVDAPAGEMT
VLLGPGWPGVLLHEAVGHGLEGDFNRKGTSAFSGRIGERVAAPGVTVVDDGSIHDRRGSL
SIDDEGTPTRETVLIEDGILKGYMQDRMNARLMGVEPTGNGRRESFQHSPMPRMTNTFMK
GGKDDPAELLSRVKKGIFAKSFGGGQVDIVSGKFVFSCTEAYRIEDGKLGAPIKGATLIG
DGPTCLTKVVGIGNDFALDEGIGMCGKGGQSVPAGVGQPTLLVEGLTVGGTAA