Protein Info for Ga0059261_2234 in Sphingomonas koreensis DSMZ 15582

Annotation: Glycerol-3-phosphate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01210: NAD_Gly3P_dh_N
  • amino acids 2 to 152 (151 residues), 153.7 bits, E=6.2e-49
• PF07479: NAD_Gly3P_dh_C
  • amino acids 173 to 305 (133 residues), 159.8 bits, E=7.6e-51
• PF20618: GPD_NAD_C_bact
  • amino acids 233 to 299 (67 residues), 63.1 bits, E=4.5e-21

Best Hits

Swiss-Prot: 65% identical to GPDA1_SPHAL: Glycerol-3-phosphate dehydrogenase [NAD(P)+] 1 (gpsA1) from Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)

KEGG orthology group: K00057, glycerol-3-phosphate dehydrogenase (NAD(P)+) [EC: 1.1.1.94] (inferred from 71% identity to swi:Swit_1932)

MetaCyc: 36% identical to glycerol-3-phosphate dehydrogenase (Clostridium acetobutylicum)
Glycerol-3-phosphate dehydrogenase (NAD(P)(+)). [EC: 1.1.1.94]

Predicted SEED Role

"Glycerol-3-phosphate dehydrogenase [NAD(P)+] (EC 1.1.1.94)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization or Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 1.1.1.94)

MetaCyc Pathways

• CDP-diacylglycerol biosynthesis I (4/4 steps found)
• CDP-diacylglycerol biosynthesis II (4/4 steps found)
• phosphatidylglycerol biosynthesis I (5/6 steps found)
• phosphatidylglycerol biosynthesis II (5/6 steps found)
• glycerol-3-phosphate shuttle (2/2 steps found)
• CDP-diacylglycerol biosynthesis III (4/5 steps found)
• superpathway of phospholipid biosynthesis III (E. coli) (9/12 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (9/13 steps found)
• phosphatidate biosynthesis (yeast) (3/5 steps found)
• glucosylglycerol biosynthesis (2/5 steps found)
• 1,3-propanediol biosynthesis (engineered) (4/9 steps found)
• superpathway of phospholipid biosynthesis II (plants) (9/28 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.94

Sequence Analysis Tools

See A0A2M8WDF5 at UniProt or InterPro

Protein Sequence (325 amino acids)

>Ga0059261_2234 Glycerol-3-phosphate dehydrogenase (Sphingomonas koreensis DSMZ 15582)
MKIAVIGGGAWGTALAQVAARGGEPVTLWAREDDVTTSVNARHENSLFLPGVPLSPSIRA
TGDLADLADAEALLVVVPAQFLRSVLTQVPVECRPLVLCAKGIEAGTQKLVAEVARELHP
DAPVAVLSGPTFAHEVAKGLPTAVTLACEDDSLRERLAERLAGPAFRTYGSSDVAGAEIG
GAVKNVLAIACGVVEGAGLGLNARAALIARGFAEMTRFGVARGGRPETLAGLSGLGDLVL
TCSSINSRNFSLGVGLGQGKSAAELLADRRTVAEGAATAPVLREAARAAGVDMPVTQAVC
ALLEGTPVGQVVDALLSRPLREEHV