Protein Info for Ga0059261_2197 in Sphingomonas koreensis DSMZ 15582

Annotation: uroporphyrinogen decarboxylase (EC 4.1.1.37)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01208: URO-D
  • amino acids 12 to 347 (336 residues), 371.1 bits, E=2.6e-115
• TIGR01464: uroporphyrinogen decarboxylase
  • amino acids 15 to 347 (333 residues), 380.1 bits, E=4.5e-118

Best Hits

Swiss-Prot: 73% identical to DCUP_SPHWW: Uroporphyrinogen decarboxylase (hemE) from Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273)

KEGG orthology group: K01599, uroporphyrinogen decarboxylase [EC: 4.1.1.37] (inferred from 73% identity to swi:Swit_2833)

Predicted SEED Role

"Uroporphyrinogen III decarboxylase (EC 4.1.1.37)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 4.1.1.37)

MetaCyc Pathways

• superpathway of heme b biosynthesis from glycine (7/8 steps found)
• heme b biosynthesis I (aerobic) (3/4 steps found)
• heme b biosynthesis V (aerobic) (3/4 steps found)
• superpathway of heme b biosynthesis from glutamate (7/10 steps found)
• heme b biosynthesis II (oxygen-independent) (2/4 steps found)
• superpathway of heme b biosynthesis from uroporphyrinogen-III (3/6 steps found)
• heme b biosynthesis IV (Gram-positive bacteria) (1/5 steps found)
• 3,8-divinyl-chlorophyllide a biosynthesis I (aerobic, light-dependent) (2/9 steps found)
• 3,8-divinyl-chlorophyllide a biosynthesis III (aerobic, light independent) (2/9 steps found)
• 3,8-divinyl-chlorophyllide a biosynthesis II (anaerobic) (1/9 steps found)
• superpathway of bacteriochlorophyll a biosynthesis (5/26 steps found)

KEGG Metabolic Maps

• Porphyrin and chlorophyll metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.37

Sequence Analysis Tools

See A0A2M8WD95 at UniProt or InterPro

Protein Sequence (351 amino acids)

>Ga0059261_2197 uroporphyrinogen decarboxylase (EC 4.1.1.37) (Sphingomonas koreensis DSMZ 15582)
MSGPVNSNLLPSKPLLDVLSGKRVDAPPMWLMRQAGRYLPEYRALRAEKGGFLELVNDSE
AAAEVTLQPIRRFGFDGAILFSDILVVPHALGQDLWFEAGEGPRLAPKLVDHALESLTAA
PERLNPVYGTVRRVAAALPAQTAFLGFAGSPWTNATYMVAGQGSRDQSETRRMAYADPGA
FGAIIDAIVAMSIDYLAKQVEAGVEAVQLFDSWAGSLSPAQFERWVIAPNAAIVAGLRAR
CPQVRIIGFPKGAGGKLAAYARETGVDAIGLDETVDPVWAHRELPAGLPVQGNLDPLALI
AGGTELEAAVRRVLDALSDRPHIFNLGHGIQQDTPIAHVDQLIGIVRGAAK