Protein Info for Ga0059261_2193 in Sphingomonas koreensis DSMZ 15582

Annotation: dephospho-CoA kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01121: CoaE
  • amino acids 2 to 177 (176 residues), 147.4 bits, E=1.9e-47
• TIGR00152: dephospho-CoA kinase
  • amino acids 3 to 180 (178 residues), 120.2 bits, E=4.8e-39

Best Hits

Swiss-Prot: 62% identical to COAE_NOVAD: Dephospho-CoA kinase (coaE) from Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CIP 105152 / NBRC 16084 / F199)

KEGG orthology group: K00859, dephospho-CoA kinase [EC: 2.7.1.24] (inferred from 66% identity to swi:Swit_2829)

Predicted SEED Role

"Dephospho-CoA kinase (EC 2.7.1.24)" in subsystem Coenzyme A Biosynthesis (EC 2.7.1.24)

MetaCyc Pathways

• superpathway of coenzyme A biosynthesis I (bacteria) (8/9 steps found)
• superpathway of coenzyme A biosynthesis III (mammals) (5/5 steps found)
• coenzyme A biosynthesis I (bacteria) (4/4 steps found)
• coenzyme A biosynthesis II (eukaryotic) (4/4 steps found)

KEGG Metabolic Maps

• Pantothenate and CoA biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.24

Sequence Analysis Tools

See A0A2M8WDB4 at UniProt or InterPro

Protein Sequence (197 amino acids)

>Ga0059261_2193 dephospho-CoA kinase (Sphingomonas koreensis DSMZ 15582)
MIILGLTGSIGMGKSTVAAMFADDGVPVFDADAEVHRLQGPGGRLVRQIESAFPGTTGES
GVDRALLGKAVFGNPDALKRLEAIVHPAVADERAAFLESNRAQPLVVLDIPLLFEAGGWQ
QVDKIAVVSAPADIQRARVLARPGMTGERFESILSKQMPDSEKRKRADFVIPTGGTLDET
RSAVRAVIACLAGTEGR