Protein Info for Ga0059261_2183 in Sphingomonas koreensis DSMZ 15582

Annotation: Uncharacterized conserved protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 145 PF03692: CxxCxxCC" amino acids 24 to 92 (69 residues), 43.5 bits, see alignment E=2.2e-15

Best Hits

Swiss-Prot: 70% identical to Y2819_SPHWW: UPF0260 protein Swit_2819 (Swit_2819) from Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273)

KEGG orthology group: K09160, hypothetical protein (inferred from 71% identity to sal:Sala_2978)

Predicted SEED Role

"conserved protein of unknown function; putative YcgN protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WDA1 at UniProt or InterPro

Protein Sequence (145 amino acids)

>Ga0059261_2183 Uncharacterized conserved protein (Sphingomonas koreensis DSMZ 15582)
LDRITPFWEQPLSTLDRAQWEALCDGCGKCCLHKIEDEDTGDVYATNVACRLLDRQTGFC
SDYKHRRAYVAECVRLTASNVEDIAWLPRTCAYRLRANDEPLPHWHYLVSGDREAVHAAG
ESVRGWTISEDVAGDLEHHMVDRLL