Protein Info for Ga0059261_2127 in Sphingomonas koreensis DSMZ 15582

Annotation: NUDIX domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 178 PF00293: NUDIX" amino acids 37 to 109 (73 residues), 46.7 bits, see alignment E=1.6e-16

Best Hits

KEGG orthology group: K01515, ADP-ribose pyrophosphatase [EC: 3.6.1.13] (inferred from 66% identity to npp:PP1Y_AT20347)

Predicted SEED Role

"ADP-ribose pyrophosphatase (EC 3.6.1.13)" in subsystem NAD and NADP cofactor biosynthesis global or Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.13)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WD16 at UniProt or InterPro

Protein Sequence (178 amino acids)

>Ga0059261_2127 NUDIX domain (Sphingomonas koreensis DSMZ 15582)
VTTPDADAPVETVWQGRFLTAKKQGRWEYVARARGIRAAVIVAIDEDGQLILVEQYRVPL
GRACLELPAGLVGDENESEAVEIAAARELEEETGYRPGRIESLGEYFSSPGMVSESFTLV
RARDLVRVGEGGGVEGEGITVHRVKLDDVPAFVETCRARGMAIDVKLLLVLGQTFLGA