Protein Info for Ga0059261_2096 in Sphingomonas koreensis DSMZ 15582

Annotation: Flagellar basal-body P-ring protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF02119: FlgI" amino acids 22 to 363 (342 residues), 445.9 bits, see alignment E=4.3e-138

Best Hits

Swiss-Prot: 70% identical to FLGI_SPHWW: Flagellar P-ring protein (flgI) from Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273)

KEGG orthology group: K02394, flagellar P-ring protein precursor FlgI (inferred from 70% identity to swi:Swit_1264)

Predicted SEED Role

"Flagellar P-ring protein FlgI" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1L6J7R4 at UniProt or InterPro

Protein Sequence (364 amino acids)

>Ga0059261_2096 Flagellar basal-body P-ring protein (Sphingomonas koreensis DSMZ 15582)
MTRFLIALLTAFLFAQPVAAERIKDLGAFQGIRSNQLTGYGIVVGLPGTGDDNLEYTVQS
MKGVTARFGLALPPGVNPALKNAAVVMITAELPPFAKPGQKLDITVSSMGKAKSLRGGTL
VLTPLIGADGQIYAMAQGNLAVGGLGAEGADGSKIVVNTPSSGRIPEGATVERAVETGFA
DTPMLTYNLARSDFTTAQRVADAINGRFGFGTARAIDGVSVAVMAKPGADVRAQMMSEIE
NLAVDAAEAPAKVIVNARTGTVVINSAVRVSPAAVTHGKLTVRIDEAQRVSQPAPFSQGE
TALEQRSTVGVEEERRPMFLLDPGPKLADVVKAVNAIGASPADLVAILEALKQAGALKAE
LIVL