Protein Info for Ga0059261_1973 in Sphingomonas koreensis DSMZ 15582

Annotation: NAD/NADP transhydrogenase beta subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 505 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 41 to 60 (20 residues), see Phobius details amino acids 87 to 107 (21 residues), see Phobius details amino acids 119 to 140 (22 residues), see Phobius details amino acids 167 to 188 (22 residues), see Phobius details amino acids 204 to 223 (20 residues), see Phobius details amino acids 229 to 249 (21 residues), see Phobius details amino acids 256 to 275 (20 residues), see Phobius details amino acids 280 to 299 (20 residues), see Phobius details PF02233: PNTB" amino acids 12 to 502 (491 residues), 638.6 bits, see alignment E=3.3e-196

Best Hits

Swiss-Prot: 66% identical to PNTB_RHORT: NAD(P) transhydrogenase subunit beta (pntB) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K00325, NAD(P) transhydrogenase subunit beta [EC: 1.6.1.2] (inferred from 82% identity to sal:Sala_1381)

Predicted SEED Role

"NAD(P) transhydrogenase subunit beta (EC 1.6.1.2)" in subsystem Phosphate metabolism (EC 1.6.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.1.2

Use Curated BLAST to search for 1.6.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WCM6 at UniProt or InterPro

Protein Sequence (505 amino acids)

>Ga0059261_1973 NAD/NADP transhydrogenase beta subunit (Sphingomonas koreensis DSMZ 15582)
MHEAVPLNPWVALAYLVAGVCFIVALRGLSSPATSRRGNRFGMAGMLIAVVTTLVTHLPL
KSTGSCDNIQPQAGMDTFCTEIFATDFASAGEILIAIAVGAVVGIVMARKIKMTDMPQLV
AGFHSLVGLAAVLVGVAAYLNPEAFGIVFPAGSPDAGLILPVSRIELGLGVAIGAITFSG
SVIAFLKLNGNMGGAPIMLPGRHVINLGTLAAILGLIAFLTVELRAPDWVFWTVLVLSFV
IGFLLIIPIGGADMPVVVSMLNSYSGWAAAAMGFTLGNTAMIITGALVGSSGAILSYIMC
RAMNRSFISVIAGGFGGDSGGGAAAAATDRPWKRGSAEDAAFLMSQAEQVIIVPGYGMAV
AQAQHVLREMADKLKEHGVRVKYAIHPVAGRMPGHMNVLLAEANVPYDEVFELEDINSEF
SQTDVAFIIGANDVVNPAAKTDKSSPIYGMPVFDVNKAKTVLFIKRSMGGVGYAGVDNDV
FYQDNTMMLLADAKKMVEEIVKSLD