Protein Info for Ga0059261_1965 in Sphingomonas koreensis DSMZ 15582

Annotation: dihydropteroate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 362 transmembrane" amino acids 279 to 299 (21 residues), see Phobius details TIGR01496: dihydropteroate synthase" amino acids 96 to 352 (257 residues), 280.3 bits, see alignment E=8.6e-88 PF00809: Pterin_bind" amino acids 98 to 339 (242 residues), 235.5 bits, see alignment E=3.8e-74

Best Hits

KEGG orthology group: K00796, dihydropteroate synthase [EC: 2.5.1.15] (inferred from 62% identity to sjp:SJA_C1-27270)

Predicted SEED Role

"Dihydropteroate synthase (EC 2.5.1.15)" in subsystem Folate Biosynthesis (EC 2.5.1.15)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WCL7 at UniProt or InterPro

Protein Sequence (362 amino acids)

>Ga0059261_1965 dihydropteroate synthase (Sphingomonas koreensis DSMZ 15582)
VTLDLPRNARLYLRPVQFADSPIERDGEVARLAGGLVWFSAWELIAVENGRRILQRTIPI
ADLPDDEGLHALAARITAPRVPLTLGERVLRFDQPQVMGILNLTPDSFSDGGKHSDDPEA
AAAAGVGMAAEGATLIDVGGESTRPGAKEVWEGDEIKRVVPVIERLARSGTLVSADTRKA
GVMEAALAAGAHIVNDVSALLWDDRALDIVVRAQCPVVLMHAGDPKQGADGGHGYGDPLI
EVYDWLERRIDAVVAAGVDRARIIADPGIGFGKTLSHNLALLNGLALFHGLGVPLLLGAS
RKRIIGALSNEAPADQRLGGSLALALKGAELGVQLLRVHDVPETVQALRVWRGMRDAALV
GR