Protein Info for Ga0059261_1964 in Sphingomonas koreensis DSMZ 15582

Annotation: DNA modification methylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 PF01555: N6_N4_Mtase" amino acids 49 to 270 (222 residues), 223.2 bits, see alignment E=4.1e-70 PF18755: RAMA" amino acids 279 to 380 (102 residues), 70.3 bits, see alignment E=1.2e-23

Best Hits

Swiss-Prot: 68% identical to MTB1_OCHA4: Modification methylase BabI (ccrM) from Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / JCM 21032 / NBRC 15819 / NCTC 12168)

KEGG orthology group: K13581, modification methylase [EC: 2.1.1.72] (inferred from 78% identity to sch:Sphch_1451)

Predicted SEED Role

"Modification methylase"

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.72

Use Curated BLAST to search for 2.1.1.72

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WCP1 at UniProt or InterPro

Protein Sequence (382 amino acids)

>Ga0059261_1964 DNA modification methylase (Sphingomonas koreensis DSMZ 15582)
MGVIEKVAPARQRERAEVRTRSWVDVLPLDTIIQQDCIEAMRAMPAASIDMIFADPPYNL
QLGGDLNRPDGSFVDAVTDEWDKFDSLNAYDAFTRAWLAEARRILKPNGTIWVIGSYHNI
FKVGSAIQDLGFWILNDIIWRKANPMPNFKGTRFTNAHETLIWASMGEKAKYTFNYRSMK
TLNDELQMRSDWEFPICGGQERLKKNGVKVHPTQKPEALLYRVMLACTKPGDVILDPFFG
TGTTGAVAKRLRRHWIGIDREGTYIEAAQERIDAALPLDESAVTTMMAPRQAPRVAFGTL
IETGYLKPGTVLSDTKRRWRAVVKADGSLLTDCGTAGSIHKVGATLQGAPSCNGWTFWHY
EAENGLKPIDALRQTYLLATQP