Protein Info for Ga0059261_1949 in Sphingomonas koreensis DSMZ 15582
Annotation: Uncharacterized Zn-ribbon-containing protein involved in phosphonate metabolism
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 48% identical to YJDM_SHIFL: Protein YjdM (yjdM) from Shigella flexneri
KEGG orthology group: K06193, phosphonoacetate hydrolase [EC: 3.11.1.2] (inferred from 82% identity to sch:Sphch_2906)Predicted SEED Role
"Alkylphosphonate utilization operon protein PhnA" in subsystem Alkylphosphonate utilization
MetaCyc Pathways
- phosphonoacetate degradation (1/1 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 3.11.1.2
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A2M8WCJ6 at UniProt or InterPro
Protein Sequence (99 amino acids)
>Ga0059261_1949 Uncharacterized Zn-ribbon-containing protein involved in phosphonate metabolism (Sphingomonas koreensis DSMZ 15582) MSDDEYVYDEASGEWVPASQLAAAPSDDVVEVRDSVGNLLADGDQVTLIKDLTVKGAGQT LKRGTLIKSIRLTGDAQEIDCKFDGIKGLVLRAEFVRKR