Protein Info for Ga0059261_1946 in Sphingomonas koreensis DSMZ 15582

Annotation: ribonuclease III, bacterial

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 TIGR02191: ribonuclease III" amino acids 22 to 219 (198 residues), 207.6 bits, see alignment E=8.8e-66 PF14622: Ribonucleas_3_3" amino acids 23 to 138 (116 residues), 86.6 bits, see alignment E=2.5e-28 PF00636: Ribonuclease_3" amino acids 38 to 124 (87 residues), 71.9 bits, see alignment E=1e-23 PF00035: dsrm" amino acids 154 to 218 (65 residues), 48.5 bits, see alignment E=1.6e-16

Best Hits

Swiss-Prot: 61% identical to RNC_ZYMMO: Ribonuclease 3 (rnc) from Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)

KEGG orthology group: K03685, ribonuclease III [EC: 3.1.26.3] (inferred from 69% identity to sjp:SJA_C1-17130)

Predicted SEED Role

"Ribonuclease III (EC 3.1.26.3)" in subsystem RNA processing and degradation, bacterial or Two cell division clusters relating to chromosome partitioning (EC 3.1.26.3)

Isozymes

Compare fitness of predicted isozymes for: 3.1.26.3

Use Curated BLAST to search for 3.1.26.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WCL0 at UniProt or InterPro

Protein Sequence (221 amino acids)

>Ga0059261_1946 ribonuclease III, bacterial (Sphingomonas koreensis DSMZ 15582)
LSETLADWLARVLGNPADHLAGYERALTHGSQGAANYERLEFLGDRVLGLTIAEWLYERF
PDEPEGKLSRRFNSLVTGQVCAEVAREIGVPAHLRLGKQARDDGAASSDNVLGDVMEALI
GAHFRAHGFEPARALVRRLWDSRIDAQASAPKHPKSALQEWAAANNRRPPEYALVERSGP
GHAPRFKVLAKIGKLAEAEGEGSSKQEAETAAAAALLAAVS