Protein Info for Ga0059261_1944 in Sphingomonas koreensis DSMZ 15582

Annotation: GTP-binding protein Era

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 TIGR00231: small GTP-binding protein domain" amino acids 9 to 162 (154 residues), 69.7 bits, see alignment E=2.5e-23 TIGR00436: GTP-binding protein Era" amino acids 10 to 279 (270 residues), 238.7 bits, see alignment E=7.8e-75 PF02421: FeoB_N" amino acids 11 to 166 (156 residues), 38.1 bits, see alignment E=3.9e-13 PF00350: Dynamin_N" amino acids 11 to 44 (34 residues), 27.2 bits, see alignment 1.3e-09 PF00009: GTP_EFTU" amino acids 11 to 173 (163 residues), 32.4 bits, see alignment E=2.5e-11 PF01926: MMR_HSR1" amino acids 11 to 125 (115 residues), 85 bits, see alignment E=1.5e-27 PF10662: PduV-EutP" amino acids 11 to 168 (158 residues), 24.6 bits, see alignment E=6.7e-09 PF07650: KH_2" amino acids 208 to 284 (77 residues), 60.1 bits, see alignment E=5.3e-20

Best Hits

Swiss-Prot: 57% identical to ERA_BRUSU: GTPase Era (era) from Brucella suis biovar 1 (strain 1330)

KEGG orthology group: K03595, GTP-binding protein Era (inferred from 75% identity to sch:Sphch_0772)

Predicted SEED Role

"GTP-binding protein Era" in subsystem Bacterial Cell Division or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WCM2 at UniProt or InterPro

Protein Sequence (300 amino acids)

>Ga0059261_1944 GTP-binding protein Era (Sphingomonas koreensis DSMZ 15582)
MNIEQQRCGLIAVVGAPNAGKSTLVNALVGQKVAIVSPKAQTTRTRLMGIAIEGDAQLLL
VDTPGIFDPARRLDRAMVSAAWEGAKDADLIALVVDGKGGVGPKVRGLAESLKDRRERKL
LILNKVDIADKPRLLGHAATLNDLGAFDDTYFVSAATGDGIPELKAALAAKLPEGPWHFP
EDQVSDATDRMLAAEITREQLYLQLHAELPYASAVETEQYKEREDGSVEIHQQILVARET
QRAIVLGKGGARIKEIGARARAELAKLMGVKVHLYLHVKVRPGWEDDRTLYRDIGLDWVD