Protein Info for Ga0059261_1941 in Sphingomonas koreensis DSMZ 15582

Updated annotation (from data): DNA damage response helicase, ligase-associated
Rationale: Conserved and specific phenotype: important for resisting cisplatin. Related to Lhr, which is either a DNA:DNA or DNA:RNA helicase, but lacks the long C-terminal extension that might have a regulatory role (see putative winged helix domain in E. coli lhr). This is also related to the archael protein saci_1500, which has also been linked to DNA damage response, as a mutant is sensitive to UV (PMID: 26148716)
Original annotation: DEXH box helicase, DNA ligase-associated

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 802 TIGR04121: DEXH box helicase, DNA ligase-associated" amino acids 8 to 793 (786 residues), 1066.9 bits, see alignment E=0 PF00270: DEAD" amino acids 21 to 188 (168 residues), 95.9 bits, see alignment E=5.7e-31 PF04851: ResIII" amino acids 32 to 187 (156 residues), 27.6 bits, see alignment E=6.6e-10 PF00271: Helicase_C" amino acids 243 to 343 (101 residues), 64.9 bits, see alignment E=1.9e-21 PF19306: WH_Lhr" amino acids 372 to 535 (164 residues), 145.7 bits, see alignment E=2.3e-46 PF08494: DEAD_assoc" amino acids 585 to 766 (182 residues), 169 bits, see alignment E=2.8e-53

Best Hits

KEGG orthology group: K03724, ATP-dependent helicase Lhr and Lhr-like helicase [EC: 3.6.4.-] (inferred from 76% identity to sch:Sphch_2267)

Predicted SEED Role

"ATP-dependent helicase, DEAD/DEAH box family, associated with Flp pilus assembly" in subsystem Widespread colonization island

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.-

Use Curated BLAST to search for 3.6.4.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WCM4 at UniProt or InterPro

Protein Sequence (802 amino acids)

>Ga0059261_1941 DNA damage response helicase, ligase-associated (Sphingomonas koreensis DSMZ 15582)
MSDLPPVLEHWFASRGWTPRRHQLDMLAAGRAGRHALLVAATGAGKTLAGFLPTLTELIE
QPGEGLHTLYISPLKALAVDVQRNLLTPIEEMGLDIRVETRTGDTSHEKKVRQRARPPQI
LLTTPESLSLLLSYEDSFLMFAGLRTVVVDEVHAFATGKRGDLLALALARLQTLAPGMRR
VALSATVADPDGYRAWLAPHGEIDAVELVTGESGAEPDIAILLPEGRVPWSGHSGLYAIP
QVMAEIETHKTTIVFCNTRSLAELVFQNLWKVNELKLPIGVHHGSLSLEARQRAEQAMAE
GRLRALVATASLDLGVDWGDVDCVIQMGAPKGSSRLLQRIGRANHRLDEPSEAVLVPGNR
FEYLEARAALDAVEAGELDPDIFRPGALDVLAQHVMGLACAAPFDAAELLREIQGALPYS
ALSEDVFEAVLNFIADGGYALRAYDRFKRLTRDKDGLWRVTKPAFVAQHRLNAGIIVEAP
MLEVRFRNGRRLGRVEEAFGASLSPGDRFFFAGLALEVERVEVTDIIVRATTKTARFVSY
MGARLAITSTLAARVRRFFAEPETWSRFPADVREWLEVQAHRSRLPAPGKLLVETFPHDG
RHHMVAYCFEGWNAHQSLGMLVTRRMEALGLKPVGFVANDYALAVYGLEKIEDPAPLFSP
DILEHEFVEWVQGSALLKRAFREVAIIGGLVERQQPGKKKTGRQVTFSTDLIYDVLRKYE
PDHLLLRAAWADARARMTDIGRLARLLDTAVDRIEHVDLDRVSPMAVPVLIMIGRETVAQ
GAAEDAMLIEAEALAAEAMRID