Protein Info for Ga0059261_1920 in Sphingomonas koreensis DSMZ 15582

Annotation: amidohydrolase, PncC family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 170 PF02464: CinA" amino acids 16 to 166 (151 residues), 148.2 bits, see alignment E=7.7e-48 TIGR00199: amidohydrolase, PncC family" amino acids 25 to 164 (140 residues), 131.4 bits, see alignment E=1.5e-42

Best Hits

KEGG orthology group: K03743, (no description) (inferred from 68% identity to sjp:SJA_C1-10990)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1L6J6G6 at UniProt or InterPro

Protein Sequence (170 amino acids)

>Ga0059261_1920 amidohydrolase, PncC family (Sphingomonas koreensis DSMZ 15582)
MTETLSPVLPDEVDRAARAVLETACARKLSLATAESCTGGMLASLLTDVEGVSATFERGF
VTYSVDAKCELLGIAHDFVERCGAVSREVAVAMAIGALAASRADIALAITGFAGPAGPGD
EPGLVHFACARKGRDTAHREAHFGDIGRGPVRIECMRVALEMIAEAVKGN