Protein Info for Ga0059261_1900 in Sphingomonas koreensis DSMZ 15582

Annotation: Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 6 to 193 (188 residues), 175 bits, E=2.6e-55
• PF08659: KR
  • amino acids 9 to 172 (164 residues), 45.6 bits, E=1.6e-15
• PF13561: adh_short_C2
  • amino acids 16 to 247 (232 residues), 206.5 bits, E=9.5e-65

Best Hits

Swiss-Prot: 39% identical to YGFF_ECOLI: Uncharacterized oxidoreductase YgfF (ygfF) from Escherichia coli (strain K12)

KEGG orthology group: K00059, 3-oxoacyl-[acyl-carrier protein] reductase [EC: 1.1.1.100] (inferred from 68% identity to bsb:Bresu_2894)

Predicted SEED Role

"Acetoin(diacetyl) reductase"

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (48/53 steps found)
• palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
• superpathway of fatty acid biosynthesis II (plant) (37/43 steps found)
• oleate biosynthesis IV (anaerobic) (13/14 steps found)
• superpathway of unsaturated fatty acids biosynthesis (E. coli) (17/20 steps found)
• biotin biosynthesis I (13/15 steps found)
• palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (8/9 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (13/16 steps found)
• gondoate biosynthesis (anaerobic) (4/4 steps found)
• 8-amino-7-oxononanoate biosynthesis I (9/11 steps found)
• (5Z)-dodecenoate biosynthesis I (5/6 steps found)
• 8-amino-7-oxononanoate biosynthesis IV (4/5 steps found)
• cis-vaccenate biosynthesis (4/5 steps found)
• fatty acid elongation -- saturated (4/5 steps found)
• octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) (9/12 steps found)
• palmitate biosynthesis III (21/29 steps found)
• (5Z)-dodecenoate biosynthesis II (4/6 steps found)
• stearate biosynthesis II (bacteria and plants) (4/6 steps found)
• anteiso-branched-chain fatty acid biosynthesis (24/34 steps found)
• even iso-branched-chain fatty acid biosynthesis (24/34 steps found)
• odd iso-branched-chain fatty acid biosynthesis (24/34 steps found)
• stearate biosynthesis IV (3/6 steps found)
• petroselinate biosynthesis (2/6 steps found)
• 2-allylmalonyl-CoA biosynthesis (2/8 steps found)
• streptorubin B biosynthesis (20/34 steps found)
• tetradecanoate biosynthesis (mitochondria) (12/25 steps found)
• mycolate biosynthesis (18/205 steps found)
• superpathway of mycolate biosynthesis (19/239 steps found)

KEGG Metabolic Maps

• Biosynthesis of unsaturated fatty acids
• Fatty acid biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100

Sequence Analysis Tools

See A0A2M8WCI8 at UniProt or InterPro

Protein Sequence (250 amino acids)

>Ga0059261_1900 Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) (Sphingomonas koreensis DSMZ 15582)
MRFKDKVAIVTGGGRDIGKSISLRLAAEGAKVVINYRSDEAAAKATLDAIEAAGGTALLA
RADVTKADEVVALVKAATDAFGGKVDILVNCAGGMVARKTLAEMDEAFFDTVMDLNLKSA
FLVTKAVLPHLESGAAIVNIASQAGRDGGGPGASIYAASKGALMTLTRSWAKELGPQGIR
VNALNPGLIGTSFHDIFSKPEGRAAVAGNTPLRREGHPDEVAAAVAFLASGDASFLTGTN
VDINGGLFFS