Protein Info for Ga0059261_1891 in Sphingomonas koreensis DSMZ 15582

Annotation: MFS transporter, sugar porter (SP) family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 466 transmembrane" amino acids 7 to 28 (22 residues), see Phobius details amino acids 50 to 69 (20 residues), see Phobius details amino acids 81 to 98 (18 residues), see Phobius details amino acids 104 to 127 (24 residues), see Phobius details amino acids 141 to 161 (21 residues), see Phobius details amino acids 181 to 200 (20 residues), see Phobius details amino acids 261 to 284 (24 residues), see Phobius details amino acids 299 to 320 (22 residues), see Phobius details amino acids 327 to 347 (21 residues), see Phobius details amino acids 364 to 389 (26 residues), see Phobius details amino acids 401 to 419 (19 residues), see Phobius details amino acids 424 to 449 (26 residues), see Phobius details TIGR00879: MFS transporter, sugar porter (SP) family" amino acids 5 to 463 (459 residues), 360.8 bits, see alignment E=5.7e-112 PF00083: Sugar_tr" amino acids 16 to 465 (450 residues), 374.6 bits, see alignment E=1.1e-115 PF07690: MFS_1" amino acids 21 to 411 (391 residues), 116 bits, see alignment E=2.7e-37 PF06609: TRI12" amino acids 61 to 210 (150 residues), 25.7 bits, see alignment E=6e-10

Best Hits

Swiss-Prot: 46% identical to GLCP_SYNY3: Glucose transport protein (gtr) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: None (inferred from 70% identity to npp:PP1Y_Mpl1065)

Predicted SEED Role

"D-xylose proton-symporter XylE" in subsystem Xylose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WCF0 at UniProt or InterPro

Protein Sequence (466 amino acids)

>Ga0059261_1891 MFS transporter, sugar porter (SP) family (Sphingomonas koreensis DSMZ 15582)
MNGESRANMGLIMAIVAVATIGGLLFGYDSGAVNGTQDGLKSAFALSEGGLGFTVGSLLI
GCFIGAFLAGRLADLIGRRNVMILTAVLFLIGALIQGFSHEQWIFVAARIAGGMAVGAAS
VLSPAYISEVAPANIRGRMTTIQQIMIISGLTAAFVVNYWLAKTAGASTNLFWGGYEAWR
WMYWMQAIPATVFLIALFFIPESPRYLVSKGRNAEATRVLTSLFGAGTATNKLTEIQASF
SDHRPTLRDILDPVKGGVRPIVWAGLLLAVFQQLVGINVIFYYGATLWQLAGFTENDALL
INIVSGFVSIAACFVTVALVDRIGRKPLLLIGSAGMAVALFAMVFAFSRGSLDAQGKLVL
SQQLGIIAVIAANLYVVFFNVSWGPVMWVMLGEMFPNQIRGSALAVCGFAQWFSNYLIAQ
SFPIMAAGLGLAVSYSFYAVCAVISFFLVSKFIHETKGVELEDMQG