Protein Info for Ga0059261_1835 in Sphingomonas koreensis DSMZ 15582

Annotation: Dihydrofolate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01872: RibD_C
  • amino acids 9 to 190 (182 residues), 54.6 bits, E=6.6e-19

Best Hits

KEGG orthology group: None (inferred from 62% identity to rec:RHECIAT_CH0002695)

Predicted SEED Role

"Dihydrofolate reductase (EC 1.5.1.3)" in subsystem Folate Biosynthesis (EC 1.5.1.3)

MetaCyc Pathways

• folate transformations III (E. coli) (8/9 steps found)
• superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
• dTMP de novo biosynthesis (mitochondrial) (3/3 steps found)
• tetrahydrofolate biosynthesis I (3/3 steps found)
• superpathway of tetrahydrofolate biosynthesis (8/10 steps found)
• folate transformations II (plants) (8/11 steps found)
• superpathway of chorismate metabolism (37/59 steps found)

KEGG Metabolic Maps

• Biosynthesis of phenylpropanoids
• Folate biosynthesis
• One carbon pool by folate

Isozymes

Compare fitness of predicted isozymes for: 1.5.1.3

Use Curated BLAST to search for 1.5.1.3

Sequence Analysis Tools

See A0A2M8WCB0 at UniProt or InterPro

Protein Sequence (213 amino acids)

>Ga0059261_1835 Dihydrofolate reductase (Sphingomonas koreensis DSMZ 15582)
MSKVRVNGFSISADGFGAGPGQSLENPLGRGANFHDWLVSSRYFKTMIGQDGGAEGIDNA
FAERSMAGLGAWVMGRNMFGPVRGPWPDGEWKGWWGDNPPYHCPVYVLTHHARAPLEMDG
GTVFHFVTEGPDKALELARAAAGDRDIRIGGGIATVRHYLKAGAIDEAHIAIAPSLLGKG
EALFAGIDLPALGYSVTERVPGEQALHLVLTRG