Protein Info for Ga0059261_1806 in Sphingomonas koreensis DSMZ 15582

Annotation: Dipeptidyl aminopeptidases/acylaminoacyl-peptidases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 683 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF02129: Peptidase_S15" amino acids 387 to 529 (143 residues), 40.3 bits, see alignment E=9.3e-14 PF20434: BD-FAE" amino acids 409 to 600 (192 residues), 42.4 bits, see alignment E=1.8e-14 PF12697: Abhydrolase_6" amino acids 415 to 621 (207 residues), 29.3 bits, see alignment E=4.1e-10 PF01738: DLH" amino acids 433 to 627 (195 residues), 32.1 bits, see alignment E=2.6e-11 PF00326: Peptidase_S9" amino acids 433 to 644 (212 residues), 136.9 bits, see alignment E=2.1e-43

Best Hits

Predicted SEED Role

"Dipeptidyl anminopeptidase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WC58 at UniProt or InterPro

Protein Sequence (683 amino acids)

>Ga0059261_1806 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases (Sphingomonas koreensis DSMZ 15582)
MKRLAIALLSGAVLLSAGAAVATPPQGGADTLIPRAKIFGNPSRAGGQISPDGRHVSWLA
PVGGVMNVWVAPIGNLGAAKAVTRESKRGLQSYFWAPDGAHIIYLQDSGGNENFRVHSVE
IATLKDVALTKAGDKVRAQIQGVSKERPDVVLIGLNDRNPQFFDLYEVDYKTGASKLVME
NPGYGGFVTDNQLKPRFAFQQVPGGGSKYFRLGADGKWAEAFAIANEDFFTTNPVGFNKD
GSVLYWADSRGRDKAALVKMDVATLKTEVIAASDKADIAGLLTDPDTYEPIAYSVNYLKN
EWTPLNAAAKADLEFLRSKLPGEVAITSATDDGSKLIVAASAAERPATAYIYDRKAKTLT
KLYETRPDLAAYKLRPLWPVEIPSGDGKTLVSYLTLPAGADADNDGKPDKPVPLVLAVHG
GPWARDSYGYISTHQWLANRGYAVLSVNYRGSTGFGKGFINAAIGEWSGKMHQDLLDAVD
WAVKGGITTKDKVAIFGGSYGGYATLVGLTFTPDSFACGVDIVGPSNLRTLMESFPAYWR
PILEGTFYKHIGDPGKPEDLKRMMAQSPISRVDAIRKPLLIGQGGNDPRVVKAESDQIVA
AMKAKNLPVTYINYPDEGHGFVRPENRLSFFGITEGFLAKCLGGKSQPIGGDFAGSSLQV
LEGASYVPGLAEAAPKVAAPAAK