Protein Info for Ga0059261_1699 in Sphingomonas koreensis DSMZ 15582

Annotation: Imidazolonepropionase and related amidohydrolases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF01979: Amidohydro_1" amino acids 76 to 423 (348 residues), 173.2 bits, see alignment E=9.4e-55 PF07969: Amidohydro_3" amino acids 118 to 406 (289 residues), 35.2 bits, see alignment E=1e-12

Best Hits

KEGG orthology group: None (inferred from 54% identity to hne:HNE_0934)

Predicted SEED Role

"Xaa-Pro dipeptidase family enzyme"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WBY6 at UniProt or InterPro

Protein Sequence (429 amino acids)

>Ga0059261_1699 Imidazolonepropionase and related amidohydrolases (Sphingomonas koreensis DSMZ 15582)
MKKVIFAALAGAAFIQPAIAQDAPARTYVQAGRLLADPASGRVETEKTIVVERGKVVEIR
DGYVGEGKVVDLRDAFVMPGFIDSHVHLTFESSPTSRLDAVTKSTTDQAFDGVVYAGRTV
RAGFTTVVDLGASQEAINALRAATASGKIVGPRIIAAGGVAAHGGHGDVHGYRQEIIDLF
RSPTLCSGADDCARAVRQAIQGGADIIKTASTGGVMSNTAAGLGQQMSDAELVSIVETAH
RLGRKVAAHAHGTDGVNAALRAGVDSVEHGTFMDPESIRLFKAKGSYLVPTLLAGDTVTQ
QAATADWMPEPVRVKARTVGPLMVDALRRAHQGGVKIAFGTDSAVSKHGDNAREFALMVK
AGMTPLDTIRAATVWGATHIGLENEIGSIAAGKAADIVAVRGDPLKDVRQLETMHFVMKG
GAVVRPAGE