Protein Info for Ga0059261_1654 in Sphingomonas koreensis DSMZ 15582

Annotation: Na+/H+-dicarboxylate symporters

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 47 to 68 (22 residues), see Phobius details amino acids 80 to 102 (23 residues), see Phobius details amino acids 145 to 164 (20 residues), see Phobius details amino acids 180 to 204 (25 residues), see Phobius details amino acids 210 to 232 (23 residues), see Phobius details amino acids 252 to 273 (22 residues), see Phobius details amino acids 302 to 319 (18 residues), see Phobius details amino acids 324 to 343 (20 residues), see Phobius details amino acids 349 to 373 (25 residues), see Phobius details PF00375: SDF" amino acids 12 to 400 (389 residues), 321 bits, see alignment E=6e-100

Best Hits

KEGG orthology group: None (inferred from 51% identity to pzu:PHZ_c0351)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2M8WBR5 at UniProt or InterPro

Protein Sequence (418 amino acids)

>Ga0059261_1654 Na+/H+-dicarboxylate symporters (Sphingomonas koreensis DSMZ 15582)
MKLVNAWFATALWKRVVAGMVLGLLLALVWPAAAPKVAILGELFVRLIRMLVVPIVFISI
ASGITALGDTRKLGSVGLRTVGLFALTTLTAVAIGMTVGMLLEPGVGANVGGGAPRELGA
AKTVYEQLVGIIPLNILQAMVEGDMLAILFAATLLGAGVIAAGDAGRPVAGFLQSLSAVL
FQVIRIVMEVTPFGVFALIAGAVAANGLTVFTHIGLLAAAVAIASLLQILIVHSPLIRWG
AGMPVPRFFRSIADALAVAFSTASSSATLPVALRVACDRLKIDRAIASTTLPLGASIGKD
GTAMYVGLLSVFALQAFGVQIDAGVFLTLLFVGALTAFGTAPIPSASLFMLTAVLPTVGV
TPEQTALLVGFILPFDRLLDMTRTVPSACANLTVCTIVARTEGAIGNEPHAEVESTAA